Rabbit anti-Human CYP1A1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16830P

• Product Name:
• Rabbit anti-Human CYP1A1 Monoclonal Antibody

• Synonym:
• AHH; AHRR; CP11; CYP1; CYPIA1; P1-450; P450-C; P450DX; CYP1A1

• Description:
• The antibody against CYP1A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human CYP1A1 (NP_000490.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CYP1A1 (NP_000490.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CYP1A1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AFKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANVQLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV

• Gene ID:
• 1543

• Uniprot-ID:
• P04798

• Purification Method:
• Hep G2

• Positive Samples:
• Affinity purification