Rabbit anti-Human CYP17A1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16798P

• Product Name:
• Rabbit anti-Human CYP17A1 Monoclonal Antibody

• Synonym:
• CPT7; CYP17; S17AH; P450C17; CYP17A1

• Description:
• The antibody against CYP17A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 101-220 of human CYP17A1 (P05093) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 101-220 of human CYP17A1 (P05093).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CYP17A1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQKLEKIICQEISTLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPW

• Gene ID:
• 1586

• Uniprot-ID:
• P05093

• Purification Method:
• PC-3, U-87MG, Mouse liver

• Positive Samples:
• Affinity purification