Rabbit anti-Human CXCL9/MIG Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15713P

• Product Name:
• Rabbit anti-Human CXCL9/MIG Monoclonal Antibody

• Synonym:
• CMK; MIG; Humig; SCYB9; crg-10; CXCL9

• Description:
• The antibody against CXCL9/MIG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-125 of human CXCL9/MIG( NP_002407.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 23-125 of human CXCL9/MIG( NP_002407.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CXCL9/MIG

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT

• Gene ID:
• 4283

• Uniprot-ID:
• Q07325

• Purification Method:
• Recombinant Human CXCL9 Protein

• Positive Samples:
• Affinity purification