Rabbit anti-Human Cullin 1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13615P

• Product Name:
• Rabbit anti-Human Cullin 1 Monoclonal Antibody

• Synonym:
• Cullin 1; CUL1; cullin-1; MGC149834; MGC149835

• Description:
• The antibody against Cullin 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 677-776 of human Cullin 1 (Q13616) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 677-776 of human Cullin 1 (Q13616).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Cullin 1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA

• Gene ID:
• 8454

• Uniprot-ID:
• Q13616

• Purification Method:
• A-549, K-562, MCF7, NIH/3T3, Mouse liver, Mouse brain, Rat testis

• Positive Samples:
• Affinity purification