Rabbit anti-Human CTIP2/BCL11B Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16253P

• Product Name:
• Rabbit anti-Human CTIP2/BCL11B Monoclonal Antibody

• Synonym:
• ATL1; RIT1; CTIP2; IMD49; CTIP-2; IDDFSTA; SMARCM2; ZNF856B; ATL1-beta; ATL1-alpha; ATL1-delta; ATL1-gamma; hRIT1-alpha; CTIP2/BCL11B

• Description:
• The antibody against CTIP2/BCL11B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-550 of human CTIP2/BCL11B (Q9C0K0) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 450-550 of human CTIP2/BCL11B (Q9C0K0).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CTIP2/BCL11B

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TGEKPYKCQLCDHACSQASKLKRHMKTHMHKAGSLAGRSDDGLSAASSPEPGTSELAGEGLKAADGDFRHHESDPSLGHEPEEEDEEEEEEEEELLLENES

• Gene ID:
• 64919

• Uniprot-ID:
• Q9C0K0

• Purification Method:
• Jurkat, Raji, SH-SY5Y

• Positive Samples:
• Affinity purification