Rabbit anti-Human CSNK2A2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13207P

• Product Name:
• Rabbit anti-Human CSNK2A2 Monoclonal Antibody

• Synonym:
• CK2A2; CSNK2A1; CK2alpha'; CSNK2A2

• Description:
• The antibody against CSNK2A2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human CSNK2A2 (NP_001887.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CSNK2A2 (NP_001887.1).

• Species Reactivity:
• Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CSNK2A2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR

• Gene ID:
• 1459

• Uniprot-ID:
• P19784

• Purification Method:
• Mouse testis, Rat testis

• Positive Samples:
• Affinity purification