Rabbit anti-Human Complement C4A Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15856P

• Product Name:
• Rabbit anti-Human Complement C4A Monoclonal Antibody

• Synonym:
• C4; RG; C4S; CO4; C4A2; C4A3; C4A4; C4A6; C4AD; CPAMD2; Complement C4A

• Description:
• The antibody against Complement C4A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 940-1237 of human Complement C4A (P0C0L4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 940-1237 of human Complement C4A (P0C0L4).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Complement C4A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• HREELVYELNPLDHRGRTLEIPGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAPTLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTAFVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVALTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYALTLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQ

• Gene ID:
• 720

• Uniprot-ID:
• P0C0L4

• Purification Method:
• Hep G2

• Positive Samples:
• Affinity purification