Rabbit anti-Human Collagen IV Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15450P

• Product Name:
• Rabbit anti-Human Collagen IV Monoclonal Antibody

• Synonym:
• BFH; ATS2; BFH1; CA44; Collagen IV

• Description:
• The antibody against Collagen IV was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1573-1690 of human COL4A4（NP_000083.3） as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA, DB.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1573-1690 of human COL4A4（NP_000083.3）.

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA, DB

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Collagen IV

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGGGQALMSPGSCLEDFRAAPFLECQGRQGTCHFFANKYSFWLTTVKADLQFSSAPAPDTLKESQAQRQKISRCQVCVKYS

• Gene ID:
• 1286128812841282

• Uniprot-ID:
• P53420

• Purification Method:
• HeLa

• Positive Samples:
• Affinity purification