Rabbit anti-Human COL11A1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15534P

• Product Name:
• Rabbit anti-Human COL11A1 Monoclonal Antibody

• Synonym:
• STL2; COLL6; CO11A1; DFNA37; COL11A1

• Description:
• The antibody against COL11A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 301-400 of human COL11A1 mAb (NP_001845.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 301-400 of human COL11A1 mAb (NP_001845.3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• 59% PBS with 0.01% Sodium azide, 0.05% BSA, 40% Glycerol, PH 7.2

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• COL11A1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NIVDDFQEYNYGTMESYQTEAPRHVSGTNEPNPVEEIFTEEYLTGEDYDSQRKNSEDTLYENKEIDGRDSDLLVDGDLGEYDFYEYKEYEDKPTSPPNEE

• Gene ID:
• 1301

• Uniprot-ID:
• P12107

• Purification Method:
• A-204, U-2 OS(Low expression control)

• Positive Samples:
• Affinity purification