• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Monoclonal Antibody >

Rabbit anti-Human COL11A1 Monoclonal Antibody Online Inquiry

  • Cat#:
  • ADA-15534P
  • Product Name:
  • Rabbit anti-Human COL11A1 Monoclonal Antibody
  • Synonym:
  • STL2; COLL6; CO11A1; DFNA37; COL11A1
  • Description:
  • The antibody against COL11A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 301-400 of human COL11A1 mAb (NP_001845.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • A synthetic peptide corresponding to a sequence within amino acids 301-400 of human COL11A1 mAb (NP_001845.3).
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • WB, IF/ICC, ELISA
  • Storage Buffer:
  • 59% PBS with 0.01% Sodium azide, 0.05% BSA, 40% Glycerol, PH 7.2
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Monoclonal
  • Target Name:
  • COL11A1
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • NIVDDFQEYNYGTMESYQTEAPRHVSGTNEPNPVEEIFTEEYLTGEDYDSQRKNSEDTLYENKEIDGRDSDLLVDGDLGEYDFYEYKEYEDKPTSPPNEE
  • Gene ID:
  • 1301
  • Purification Method:
  • A-204, U-2 OS(Low expression control)
  • Positive Samples:
  • Affinity purification
  • Pre product:Rabbit anti-Mouse CD44 Monoclonal Antibody-ADA-15533P
  • Online Inquiry

    refresh