Rabbit anti-Human Clusterin Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15798P

• Product Name:
• Rabbit anti-Human Clusterin Monoclonal Antibody

• Synonym:
• CLI; AAG4; APOJ; CLU1; CLU2; KUB1; SGP2; APO-J; SGP-2; SP-40; TRPM2; TRPM-2; NA1/NA2; Clusterin

• Description:
• The antibody against Clusterin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 314-449 of human Clusterin alpha chain (NP_001822.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 314-449 of human Clusterin alpha chain (NP_001822.3).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Clusterin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• STNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

• Gene ID:
• 1191

• Uniprot-ID:
• P10909

• Purification Method:
• MCF7, HeLa, Human plasma, Mouse plasma

• Positive Samples:
• Affinity purification