• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Monoclonal Antibody >

Rabbit anti-Human Claudin 6 Monoclonal Antibody Online Inquiry

  • Cat#:
  • ADA-13362P
  • Product Name:
  • Rabbit anti-Human Claudin 6 Monoclonal Antibody
  • Description:
  • The antibody against Claudin 6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 121-220 of human Claudin 6 (NP_067018.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • A synthetic peptide corresponding to a sequence within amino acids 121-220 of human Claudin 6 (NP_067018.2).
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • WB, ELISA
  • Storage Buffer:
  • PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Monoclonal
  • Target Name:
  • Claudin 6
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • SGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
  • Gene ID:
  • 9074
  • Purification Method:
  • OVCAR3
  • Positive Samples:
  • Affinity purification
  • Pre product:Rabbit anti-Human CD32A + CD32B + CD32C Monoclonal Antibody-ADA-13360P
  • Online Inquiry

    refresh