Rabbit anti-Human CFAP20/GTL3 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15675P

• Product Name:
• Rabbit anti-Human CFAP20/GTL3 Monoclonal Antibody

• Synonym:
• GTL3; BUG22; EVORF; fSAP23; C16orf80; CFAP20/GTL3

• Description:
• The antibody against CFAP20/GTL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 94-193 of human CFAP20/GTL3 (NP_037374.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 94-193 of human CFAP20/GTL3 (NP_037374.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CFAP20/GTL3

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ

• Gene ID:
• 29105

• Uniprot-ID:
• Q9Y6A4

• Purification Method:
• Hep G2, Mouse testis

• Positive Samples:
• Affinity purification