Rabbit anti-Human Cenexin1 / ODF2 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13241P

• Product Name:
• Rabbit anti-Human Cenexin1 / ODF2 Monoclonal Antibody

• Synonym:
• CT134; ODF84; ODF2/1; ODF2/2; Cenexin1 / ODF2

• Description:
• The antibody against Cenexin1 / ODF2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 730-829 of human Cenexin1 / ODF2 (Q5BJF6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 730-829 of human Cenexin1 / ODF2 (Q5BJF6).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Cenexin1 / ODF2

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPPA

• Gene ID:
• 4957

• Uniprot-ID:
• Q5BJF6

• Purification Method:
• HeLa, HepG2, PC-3

• Positive Samples:
• Affinity purification