Rabbit anti-Human CDKN2C/p18-INK4C Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17216P

• Product Name:
• Rabbit anti-Human CDKN2C/p18-INK4C Monoclonal Antibody

• Synonym:
• p18; INK4C; p18-INK4C; 4C

• Description:
• The antibody against CDKN2C/p18-INK4C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CDKN2C/p18-INK4C (P42773) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CDKN2C/p18-INK4C (P42773).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CDKN2C/p18-INK4C

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVE

• Gene ID:
• 1031

• Uniprot-ID:
• P42773

• Purification Method:
• HeLa, 293T, NIH/3T3, Mouse lung, Mouse testis, Rat spleen, Rat kidney

• Positive Samples:
• Affinity purification