Rabbit anti-Human CDKN2A/p16INK4a Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16093P

• Product Name:
• Rabbit anti-Human CDKN2A/p16INK4a Monoclonal Antibody

• Synonym:
• ARF; MLM; P14; P16; P19; CMM2; INK4; MTS1; TP16; CDK4I; CDKN2; INK4A; MTS-1; P14ARF; P19ARF; P16INK4; P16INK4A; P16-INK4A; CDKN2A/p16INK4a

• Description:
• The antibody against CDKN2A/p16INK4a was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CDKN2A/p16INK4a (Q8N726) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CDKN2A/p16INK4a (Q8N726).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CDKN2A/p16INK4a

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MVRRFLVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPSGGAAAAPRRGAQLRRPRHSHPTRARRC

• Gene ID:
• 1029

• Uniprot-ID:
• P42771

• Purification Method:
• 293T, HeLa

• Positive Samples:
• Affinity purification