Rabbit anti-Human CDK4 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17270P

• Product Name:
• Rabbit anti-Human CDK4 Monoclonal Antibody

• Synonym:
• CMM3; PSK-J3; K4

• Description:
• The antibody against CDK4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 204-303 of human CDK4 (NP_000066.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 204-303 of human CDK4 (NP_000066.1).

• Species Reactivity:
• Human, Mouse, Rat, Monkey

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CDK4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• FAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

• Gene ID:
• 1019

• Uniprot-ID:
• P11802

• Purification Method:
• HeLa, COS-7, Mouse lung, Rat lung

• Positive Samples:
• Affinity purification