Rabbit anti-Human CDC27 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16183P

• Product Name:
• Rabbit anti-Human CDC27 Monoclonal Antibody

• Synonym:
• APC3; HNUC; NUC2; H-NUC; ANAPC3; CDC27Hs; D0S1430E; D17S978E; CDC27

• Description:
• The antibody against CDC27 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 702-824 of human CDC27 (P30260) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 702-824 of human CDC27 (P30260).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CDC27

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• NPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF

• Gene ID:
• 996

• Uniprot-ID:
• P30260

• Purification Method:
• DU 145, Mouse testis

• Positive Samples:
• Affinity purification