Rabbit anti-Human CD9 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17106P

• Product Name:
• Rabbit anti-Human CD9 Monoclonal Antibody

• Synonym:
• MIC3; MRP-1; BTCC-1; DRAP-27; TSPAN29; TSPAN-29; CD9

• Description:
• The antibody against CD9 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 129-228 of human CD9 (P21926) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 129-228 of human CD9 (P21926).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD9

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• YNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV

• Gene ID:
• 928

• Uniprot-ID:
• P21926

• Purification Method:
• THP-1, K-562, Mouse brain, Mouse kidney

• Positive Samples:
• Affinity purification