Rabbit anti-Human CD8A Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16914P

• Product Name:
• Rabbit anti-Human CD8A Monoclonal Antibody

• Synonym:
• CD8; p32; Leu2; CD8alpha; CD8A

• Description:
• The antibody against CD8A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 136-235 of human CD8A (P01732) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 136-235 of human CD8A (P01732).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, FC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD8A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• KPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV

• Gene ID:
• 925

• Uniprot-ID:
• P01732

• Purification Method:
• PC-3 cells, THP-1 cells

• Positive Samples:
• Affinity purification