Rabbit anti-Human CD8A Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15706P

• Product Name:
• Rabbit anti-Human CD8A Monoclonal Antibody

• Synonym:
• CD8; p32; Leu2; CD8alpha

• Description:
• The antibody against CD8A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-182 of human CD8A (NP_001759.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 22-182 of human CD8A (NP_001759.3).

• Species Reactivity:
• Human, Monkey

• Isotype:
• IgG

• Application:
• FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD8A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

• Gene ID:
• 925

• Uniprot-ID:
• P01732

• Positive Samples:
• Affinity purification