Rabbit anti-Human CD86 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17022P

• Product Name:
• Rabbit anti-Human CD86 Monoclonal Antibody

• Synonym:
• B70; B7-2; B7.2; LAB72; CD28LG2; CD86

• Description:
• The antibody against CD86 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD86 (P42081) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD86 (P42081).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD86

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNL

• Gene ID:
• 942

• Uniprot-ID:
• P42081

• Purification Method:
• Raji, Jurkat, U-251MG, Mouse spleen, Mouse liver, Rat thymus

• Positive Samples:
• Affinity purification