• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Antibody > Primary Antibody > Monoclonal Antibody >

Rabbit anti-Human CD86 Monoclonal Antibody Online Inquiry

  • Cat#:
  • ADA-14539P
  • Product Name:
  • Rabbit anti-Human CD86 Monoclonal Antibody
  • Synonym:
  • B70; B7-2; B7.2; LAB72; CD28LG2; CD86
  • Description:
  • The antibody against CD86 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-241 of human CD86 (NP_787058.5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, FC, ELISA.
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant fusion protein containing a sequence corresponding to amino acids 20-241 of human CD86 (NP_787058.5).
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • WB, IF/ICC, FC, ELISA
  • Storage Buffer:
  • PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
  • Storage:
  • Store at -20℃. Avoid freeze / thaw cycles.
  • Clonality:
  • Monoclonal
  • Target Name:
  • CD86
  • Form:
  • Liquid
  • Immunogen Species:
  • Human
  • Immunogen Sequence:
  • LSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQP
  • Gene ID:
  • 942
  • Purification Method:
  • Raji
  • Positive Samples:
  • Affinity purification
  • Pre product:Rabbit anti-Human BOK Monoclonal Antibody-ADA-14538P
  • Online Inquiry

    refresh