Rabbit anti-Human CD82 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15820P

• Product Name:
• Rabbit anti-Human CD82 Monoclonal Antibody

• Synonym:
• R2; 4F9; C33; IA4; ST6; GR15; KAI1; SAR2; TSPAN27; CD82

• Description:
• The antibody against CD82 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 168-267 of human CD82 (P27701) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 168-267 of human CD82 (P27701).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD82

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIIELLGMVLSICLCRHVHSEDYSKVPKY

• Gene ID:
• 3732

• Uniprot-ID:
• P27701

• Purification Method:
• Jurkat, Raji

• Positive Samples:
• Affinity purification