Rabbit anti-Human CD79B Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14545P

• Product Name:
• Rabbit anti-Human CD79B Monoclonal Antibody

• Synonym:
• B29; IGB; AGM6; Igbeta; CD79B

• Description:
• The antibody against CD79B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 130-229 of human CD79B (NP_000617.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 130-229 of human CD79B (NP_000617.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD79B

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE

• Gene ID:
• 974

• Uniprot-ID:
• P40259

• Purification Method:
• Daudi, Raji, Mouse spleen

• Positive Samples:
• Affinity purification