Rabbit anti-Human CD79a Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16359P

• Product Name:
• Rabbit anti-Human CD79a Monoclonal Antibody

• Synonym:
• IGA; MB1; MB-1; IGAlpha; CD79a

• Description:
• The antibody against CD79a was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 165-225 of human CD79a (NP_001774.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 165-225 of human CD79a (NP_001774.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD79a

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• FRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEK

• Gene ID:
• 973

• Uniprot-ID:
• P11912

• Purification Method:
• Raji cells, Daudi cells, Mouse spleen, Rat spleen, Rat thymus

• Positive Samples:
• Affinity purification