Rabbit anti-Human CD63 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16362P

• Product Name:
• Rabbit anti-Human CD63 Monoclonal Antibody

• Synonym:
• MLA1; ME491; LAMP-3; OMA81H; TSPAN30; CD63

• Description:
• The antibody against CD63 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 103-203 of human CD63 (NP_001771.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 103-203 of human CD63 (NP_001771.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD63

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

• Gene ID:
• 967

• Uniprot-ID:
• P08962

• Purification Method:
• A375, RAW264.7, Rat kidney

• Positive Samples:
• Affinity purification