Rabbit anti-Human CD59 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13830P

• Product Name:
• Rabbit anti-Human CD59 Monoclonal Antibody

• Synonym:
• 1F5; EJ16; EJ30; EL32; G344; MIN1; MIN2; MIN3; MIRL; HRF20; MACIF; MEM43; MIC11; MSK21; 16.3A5; HRF-20; MAC-IP; p18-20; CD59

• Description:
• The antibody against CD59 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 49-128 of human CD59 (NP_000602.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 49-128 of human CD59 (NP_000602.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD59

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP

• Gene ID:
• 966

• Uniprot-ID:
• P13987

• Purification Method:
• HT-29, Hep G2, Jurkat

• Positive Samples:
• Affinity purification