Rabbit anti-Human CD48 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14302P

• Product Name:
• Rabbit anti-Human CD48 Monoclonal Antibody

• Synonym:
• BCM1; BLAST; hCD48; mCD48; BLAST1; SLAMF2; MEM-102; CD48

• Description:
• The antibody against CD48 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 27-220 of human CD48 (NP_001769.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 27-220 of human CD48 (NP_001769.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD48

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS

• Gene ID:
• 962

• Uniprot-ID:
• P09326

• Purification Method:
• Jurkat, Raji, RAW 264.7, Mouse thymus

• Positive Samples:
• Affinity purification