Rabbit anti-Human CD47 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15476P

• Product Name:
• Rabbit anti-Human CD47 Monoclonal Antibody

• Synonym:
• IAP; OA3; MER6

• Description:
• The antibody against CD47 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-139 of human CD47 (NP_001768.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 19-139 of human CD47 (NP_001768.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• FC

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD47

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

• Gene ID:
• 961

• Uniprot-ID:
• Q08722

• Purification Method:
• Jurkat

• Positive Samples:
• Affinity purification