Rabbit anti-Human CD46 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13612P

• Product Name:
• Rabbit anti-Human CD46 Monoclonal Antibody

• Synonym:
• MCP; TLX; AHUS2; MIC10; TRA2.10; CD46

• Description:
• The antibody against CD46 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD46 (P15529) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD46 (P15529).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD46

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MEPPGRRECPFPSWRFPGLLLAAMVLLLYSFSDACEEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCP

• Gene ID:
• 4179

• Uniprot-ID:
• P15529

• Purification Method:
• HeLa, MCF7, SW480, A549

• Positive Samples:
• Affinity purification