Rabbit anti-Human CD44 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15494P

• Product Name:
• Rabbit anti-Human CD44 Monoclonal Antibody

• Synonym:
• IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1; CDW44; CSPG8; H-CAM; HCELL; ECM-III; HUTCH-1; HUTCH-I; ECMR-III; Hermes-1; CD44

• Description:
• The antibody against CD44 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-178 of human CD44 (NP_000601.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, purified by protein A. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 20-178 of human CD44 (NP_000601.3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD44

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV

• Gene ID:
• 960

• Uniprot-ID:
• P16070

• Purification Method:
• HeLa

• Positive Samples:
• Protein A purified