Rabbit anti-Human CD40 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14218P

• Product Name:
• Rabbit anti-Human CD40 Monoclonal Antibody

• Synonym:
• p50; Bp50; CDW40; TNFRSF5; CD40

• Description:
• The antibody against CD40 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-193 of human CD40 (P25942) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 21-193 of human CD40 (P25942).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• FC, ELISA

• Storage Buffer:
• PBS with 0.02% thimerosal, pH7.3.

• Storage:
• Store at 4℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD40

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

• Gene ID:
• 958

• Uniprot-ID:
• P25942

• Positive Samples:
• Affinity purification