Rabbit anti-Human CD3E Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15825P

• Product Name:
• Rabbit anti-Human CD3E Monoclonal Antibody

• Synonym:
• T3E; TCRE; IMD18; CD3epsilon; CD3E

• Description:
• The antibody against CD3E was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD3E (NP_000724.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD3E (NP_000724.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD3E

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYS

• Gene ID:
• 916

• Uniprot-ID:
• P07766

• Purification Method:
• Jurkat cells

• Positive Samples:
• Affinity purification