Rabbit anti-Human CD3E+CD3G Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16225P

• Product Name:
• Rabbit anti-Human CD3E+CD3G Monoclonal Antibody

• Synonym:
• CD3E; IMD18; T3E; TCRE; CD3e molecule; CD3G; CD3-GAMMA; IMD17; T3G; CD3E+CD3G

• Description:
• The antibody against CD3E+CD3G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-207(CD3E)& 1-182(CD3G) of human CD3 epsilon&CD3 gamma Heterodimer as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-207(CD3E)& 1-182(CD3G) of human CD3 epsilon&CD3 gamma Heterodimer.

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD3E+CD3G

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI(CD3E)&MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN(CD3G)

• Gene ID:
• 916917

• Uniprot-ID:
• P07766

• Purification Method:
• Jurkat, MOLT-4

• Positive Samples:
• Affinity purification