Rabbit anti-Human CD355/CRTAM Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15513P

• Product Name:
• Rabbit anti-Human CD355/CRTAM Monoclonal Antibody

• Synonym:
• CD355; CD355/CRTAM

• Description:
• The antibody against CD355/CRTAM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 18-287 of human CD355/CRTAM (NP_062550.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 18-287 of human CD355/CRTAM (NP_062550.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IF/ICC, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD355/CRTAM

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSG

• Gene ID:
• 56253

• Uniprot-ID:
• O95727

• Purification Method:
• 293T transfected with CD355/CRTAM(Human)

• Positive Samples:
• Affinity purification