Rabbit anti-Human CD352/SLAMF6 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15394P

• Product Name:
• Rabbit anti-Human CD352/SLAMF6 Monoclonal Antibody

• Synonym:
• SLAMF6; CD352; KALI; KALIb; Ly108; NTB-A; NTBA; SF2000; SLAM family member 6; CD352/SLAMF6

• Description:
• The antibody against CD352/SLAMF6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-215 of human CD352/SLAMF6 (NP_001171643.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 24-215 of human CD352/SLAMF6 (NP_001171643.1)

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, IHC-P, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD352/SLAMF6

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• SLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCE

• Gene ID:
• 114836

• Uniprot-ID:
• Q96DU3

• Purification Method:
• Ramos, Daudi

• Positive Samples:
• Affinity purification