Rabbit anti-Human CD33 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14966P

• Product Name:
• Rabbit anti-Human CD33 Monoclonal Antibody

• Synonym:
• p67; SIGLEC3; SIGLEC-3; CD33

• Description:
• The antibody against CD33 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 18-259 of human CD33 (NP_001763.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 18-259 of human CD33 (NP_001763.3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD33

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH

• Gene ID:
• 945

• Uniprot-ID:
• P20138

• Purification Method:
• U-937, THP-1

• Positive Samples:
• Affinity purification