Rabbit anti-Human CD30 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14549P

• Product Name:
• Rabbit anti-Human CD30 Monoclonal Antibody

• Synonym:
• CD30; Ki-1; D1S166E

• Description:
• The antibody against CD30 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 19-379 of human CD30 (NP_001234.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 19-379 of human CD30 (NP_001234.3).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IHC-P, IF/ICC, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD30

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK

• Gene ID:
• 943

• Uniprot-ID:
• P28908

• Positive Samples:
• Affinity purification