Rabbit anti-Human CD300LF Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15577P

• Product Name:
• Rabbit anti-Human CD300LF Monoclonal Antibody

• Synonym:
• CD300LF; CD300f; CLM-1; CLM1; IREM-1; IREM1; IgSF13; LMIR3; NKIR; CMRF35-like molecule 1

• Description:
• The antibody against CD300LF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 20-156 of human CD300F/IREM-1 (NP_620587.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 20-156 of human CD300F/IREM-1 (NP_620587.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD300LF

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS

• Gene ID:
• 146722

• Uniprot-ID:
• Q8TDQ1

• Positive Samples:
• Affinity purification