Rabbit anti-Human CD28 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16279P

• Product Name:
• Rabbit anti-Human CD28 Monoclonal Antibody

• Synonym:
• Tp44; CD28

• Description:
• The antibody against CD28 was raised in Rabbit using the recombinant protein of human CD28 Full length（P10747） as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant protein of human CD28 Full length（P10747）.

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD28

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS

• Gene ID:
• 940

• Uniprot-ID:
• P10747

• Purification Method:
• Jurkat, U-937, Mouse spleen, Mouse thymus, Rat spleen

• Positive Samples:
• Affinity purification