Rabbit anti-Human CD20 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-17002P

• Product Name:
• Rabbit anti-Human CD20 Monoclonal Antibody

• Synonym:
• B1; S7; Bp35; CD20; FMC7; CVID5; LEU-16

• Description:
• The antibody against CD20 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 (NP_068769.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD20 (NP_068769.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD20

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILNIKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIF

• Gene ID:
• 931

• Uniprot-ID:
• P11836

• Purification Method:
• A-549, Raji, U-937

• Positive Samples:
• Affinity purification