Rabbit anti-Human CD177 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15469P

• Product Name:
• Rabbit anti-Human CD177 Monoclonal Antibody

• Synonym:
• NB1; PRV1; HNA2A; PRV-1; HNA-2a; NB1 GP; CD177

• Description:
• The antibody against CD177 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-407 of human CD177(NP_065139.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 22-407 of human CD177(NP_065139.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD177

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LLCQFGTVQHVWKVSDLPRQWTPKNTSCDSGLGCQDTLMLIESGPQVSLVLSKGCTEAKDQEPRVTEHRMGPGLSLISYTFVCRQEDFCNNLVNSLPLWAPQPPADPGSLRCPVCLSMEGCLEGTTEEICPKGTTHCYDGLLRLRGGGIFSNLRVQGCMPQPGCNLLNGTQEIGPVGMTENCNRKDFLTCHRGTTIMTHGNLAQEPTDWTTSNTEMCEVGQVCQETLLLLDVGLTSTLVGTKGCSTVGAQNSQKTTIHSAPPGVLVASYTHFCSSDLCNSASSSSVLLNSLPPQAAPVPGDRQCPTCVQPLGTCSSGSPRMTCPRGATHCYDGYIHLSGGGLSTKMSIQGCVAQPSSFLLNHTRQIGIFSAREKRDVQPPASQHEG

• Gene ID:
• 57126

• Uniprot-ID:
• Q8N6Q3

• Purification Method:
• RPMI 8226

• Positive Samples:
• Affinity purification