Rabbit anti-Human CD158a/KIR2DL1 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13457P

• Product Name:
• Rabbit anti-Human CD158a/KIR2DL1 Monoclonal Antibody

• Synonym:
• NKAT; NKAT1; p58.1; CD158A; KIR221; NKAT-1; KIR-K64; KIR2DL3; CD158a/KIR2DL1

• Description:
• The antibody against CD158a/KIR2DL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-245 of human CD158a/KIR2DL1 (NP_055033.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 22-245 of human CD158a/KIR2DL1 (NP_055033.2).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• FC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD158a/KIR2DL1

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

• Gene ID:
• 3802

• Uniprot-ID:
• P43626

• Positive Samples:
• Affinity purification