Rabbit anti-Human CD127/IL7R Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15806P

• Product Name:
• Rabbit anti-Human CD127/IL7R Monoclonal Antibody

• Synonym:
• ILRA; CD127; IL7RA; CDW127; IMD104; sIL-7R; lnc-IL7R; IL7Ralpha; IL-7Ralpha; IL-7R-alpha; CD127/IL7R

• Description:
• The antibody against CD127/IL7R was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human CD127/IL7R (P16871) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 300-400 of human CD127/IL7R (P16871).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CD127/IL7R

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• PESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPESFGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHV

• Gene ID:
• 3575

• Uniprot-ID:
• P16871

• Purification Method:
• Hep G2, PC-3, Mouse liver, Mouse thymus

• Positive Samples:
• Affinity purification