Rabbit anti-Human CBX4 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16616P

• Product Name:
• Rabbit anti-Human CBX4 Monoclonal Antibody

• Synonym:
• PC2; NBP16; CBX4

• Description:
• The antibody against CBX4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 461-560 of human CBX4 (O00257) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 461-560 of human CBX4 (O00257).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IP, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CBX4

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• EVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV

• Gene ID:
• 8535

• Uniprot-ID:
• O00257

• Purification Method:
• MCF7, 22Rv1, K-562, Mouse brain, Rat brain

• Positive Samples:
• Affinity purification