Rabbit anti-Human Cathepsin H Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-15358P

• Product Name:
• Rabbit anti-Human Cathepsin H Monoclonal Antibody

• Synonym:
• ACC4; ACC5; CPSB; ACC-4; ACC-5; Cathepsin H

• Description:
• The antibody against Cathepsin H was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 150-250 of human Cathepsin H (NP_004381.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 150-250 of human Cathepsin H (NP_004381.2).

• Species Reactivity:
• Human, Mouse

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Cathepsin H

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• LESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVS

• Gene ID:
• 1512

• Uniprot-ID:
• P09668

• Purification Method:
• A-431, Raji, Mouse lung

• Positive Samples:
• Affinity purification