Rabbit anti-Human Caspase-9 Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-13190P

• Product Name:
• Rabbit anti-Human Caspase-9 Monoclonal Antibody

• Synonym:
• MCH6; APAF3; APAF-3; PPP1R56; ICE-LAP6; Caspase-9

• Description:
• The antibody against Caspase-9 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Caspase-9 (P55211) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Caspase-9 (P55211).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, ELISA

• Storage Buffer:
• PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Caspase-9

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGSRRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSK

• Gene ID:
• 842

• Uniprot-ID:
• P55211

• Purification Method:
• Jurkat, 293T

• Positive Samples:
• Affinity purification