Rabbit anti-Human CAMK2A Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16367P

• Product Name:
• Rabbit anti-Human CAMK2A Monoclonal Antibody

• Synonym:
• CAMKA; MRD53; MRT63; CaMKIIalpha; CaMKIINalpha; CAMK2A

• Description:
• The antibody against CAMK2A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 201-300 of human CAMK2A(NP_741960.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• A synthetic peptide corresponding to a sequence within amino acids 201-300 of human CAMK2A(NP_741960.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• CAMK2A

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• VILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK

• Gene ID:
• 815

• Uniprot-ID:
• Q9UQM7

• Purification Method:
• 293T, U-87MG, Mouse brain, Mouse skeletal muscle, Rat brain

• Positive Samples:
• Affinity purification