Rabbit anti-Human Calretinin Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-14706P

• Product Name:
• Rabbit anti-Human Calretinin Monoclonal Antibody

• Synonym:
• CR; CAL2; CAB29; Calretinin

• Description:
• The antibody against Calretinin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-271 of human Calretinin (NP_001731.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 1-271 of human Calretinin (NP_001731.2).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IF/ICC, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Calretinin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIVLCSEPPM

• Gene ID:
• 794

• Uniprot-ID:
• P22676

• Purification Method:
• HeLa, A-431, U-2 OS, Mouse brain, Rat brain

• Positive Samples:
• Affinity purification