Rabbit anti-Human Calreticulin Monoclonal Antibody Online Inquiry

• Cat#:
• ADA-16809P

• Product Name:
• Rabbit anti-Human Calreticulin Monoclonal Antibody

• Synonym:
• RO; CRT; SSA; cC1qR; HEL-S-99n; Calreticulin

• Description:
• The antibody against Calreticulin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 18-203 of human Calreticulin (NP_004334.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fusion protein containing a sequence corresponding to amino acids 18-203 of human Calreticulin (NP_004334.1).

• Species Reactivity:
• Human, Mouse, Rat

• Isotype:
• IgG

• Application:
• WB, IHC-P, IP, ELISA

• Storage Buffer:
• PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.

• Storage:
• Store at -20℃. Avoid freeze / thaw cycles.

• Clonality:
• Monoclonal

• Target Name:
• Calreticulin

• Form:
• Liquid

• Immunogen Species:
• Human

• Immunogen Sequence:
• EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFL

• Gene ID:
• 811

• Uniprot-ID:
• P27797

• Purification Method:
• SH-SY5Y, Mouse brain, Rat liver, Rat brain

• Positive Samples:
• Affinity purification